The adipose tissue exclusively expresses and secretes Adiponectin (Acrp30). Acrp30 is involved in various physiological processes such as energy homeostasis, insulin sensitivity, hormonal processes, fatty acid metabolism and obesity.
Adiponectin circulates in the plasma. Decreased levels of Adiponectin are associated with insulin resistance and hyperinsulinemia, as seen in people with obesity insulin resistance, and diabetes type 2, whose plasma levels of adiponectin are reduced.
The modular structure of Acrp30 is comprised of N-terminal collagenous domain followed by a C-terminal globular domain.
Acrp30 also acts as a significant negative regulator in hematopoiesis and immune systems; it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin inhibits endothelial NF-kappa-b signaling through a cAMP-dependent pathway, it also inhibits TNF-alpha- induced expression of endothelial adhesion molecules.

Patent Rights

The sale and/or commercial use of Recombinant Adiponectin is prohibited in the United States of America (U.S.A).

Description

The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).

Source

Escherichia Coli.

Physical Appearance

Sterile Filtered clear solution.

Formulation

Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1mM DTT.

Storage

Store Acrp30 at -20°C. Can be stored at 4°C for a limited period of time of 7 days.

Purity

Acrp30 purity is greater than 90% as determined by SDS-PAGE.

Amino Acid Sequence

MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGE
KGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSV
GLETYVTIPNMPIRFTKIFYNNHYDGSTGKFHCNIPGLYYFAYHITVYMKD
VKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGE
RNGLYADNDNDSTFTGFLLYHDTN.

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Related Products

» Acrp30 Antibody

» Acrp30 Human

» Acrp30 Human, HEK

» Acrp30 Human, His

» Acrp30 Human, Trimeric

» Acrp30 Mouse, HEK

» Acrp30 Mouse, His

» Acrp30 Mouse, Trimeric

» gAcrp30 Human

» gAcrp30 Human, His

» gAcrp30 Mouse

Related Products

Activin A cyt-569 Recombinant Human Activin-A

Activin A Plant-Active cyt-414 Recombinant Human Activin-A Active

Activin A HEK-Active cyt-078 Recombinant Human Activin-A HEK-Active

Activin A Plant cyt-052 Recombinant Human Activin-A, Plant

Activin B Active cyt-057 Recombinant Human Activin-B Active

Activin B cyt-058 Recombinant Human Activin-B

Activin A, Active cyt-145 Recombinant Human Activin-A, Active

mActivin A cyt-146 Recombinant Mouse Activin-A

rActivin A cyt-147 Recombinant Rat Activin-A

Acrp30 cyt-024 Human Adiponectin

Acrp30 cyt-280 Recombinant Human Adiponectin

Acrp30 His cyt-433 Recombinant Human Adiponectin, His tag

mAcrp30 His cyt-537 Recombinant Mouse Adiponectin, His tag

Acrp30 HEK cyt-434 Recombinant Human Adiponectin glycosilated, HEK

mAcrp30 HEK cyt-435 Recombinant Mouse Adiponectin glycosilated, HEK

pAcrp30 HEK cyt-696 Recombinant Porcine Adiponectin glycosilated, HEK

Acrp30 Tri cyt-233 Recombinant Human Adiponectin Trimeric Form

mAcrp30 Tri cyt-247 Recombinant Mouse Adiponectin Trimeric Form

gAcrp30 cyt-615 Recombinant Human Adiponectin Globular

gAcrp30 His cyt-277 Recombinant Human Adiponectin Globular, His tag

mgAcrp30 cyt-432 Recombinant Mouse Adiponectin Globular

AIF1 cyt-697 Recombinant Human Allograft Inflammatory Factor 1

AIF1L cyt-007 Recombinant Human Allograft Inflammatory Factor 1 Like

AITRL cyt-076 Recombinant Human AITRL

AITRL His cyt-317 Recombinant Human AITRL, His Tag

ANGPT1 cyt-074 Recombinant Human Angiopoietin-1

ANGPTL3 cyt-248 Recombinant Human Angiopoietin-like Protein 3

ANGPTL4 cyt-249 Recombinant Human Angiopoietin-like Protein 4

ANGPTL4 HEK cyt-698 Recombinant Human Angiopoietin-like Protein 4, HEK

APOA1 cyt-661 Recombinant Human Apolipoprotein A-I

APOA1 cyt-037 Human Apolipoprotein A-I

APOA2 cyt-038 Human Apolipoprotein A-II

APOA5 cyt-025 Recombinant Human Apolipoprotein A-V

AREG cyt-041 Recombinant Human Amphiregulin

Clusterin cyt-278 Recombinant Human Apoliprotein-J

Clusterin cyt-548 Human Apoliprotein-J

rClusterin cyt-437 Recombinant Rat Apoliprotein-J

k9Clusterin cyt-549 Recombinant Canine Apoliprotein-J

k9Clusterin HEK cyt-618 Recombinant Canine Apoliprotein-J HEK

APO D cyt-547 Recombinant Human Apoliprotein-D

APO D GST cyt-652 Recombinant Human APO-D GST Tag

APOH cyt-189 Recombinant Human Apoliprotein-H

APOM cyt-715 Recombinant Human Apolipoprotein-M

APOM HEK cyt-026 Recombinant Human Apolipoprotein-M, HEK

Artemin cyt-306 Recombinant Human Artemin

BD 1 cyt-564 Recombinant Human Beta Defensin -1

mBD 1 cyt-044 Recombinant Mouse Beta Defensin -1

rBD 1 cyt-062 Recombinant Rat Beta Defensin -1

BD 2 cyt-571 Recombinant Human Beta Defensin -2

mBD 2 cyt-035 Recombinant Mouse Beta Defensin -2

BD 3 cyt-461 Recombinant Human Beta Defensin -3

mBD 3 cyt-036 Recombinant Mouse Beta Defensin -3

rBD 3 cyt-063 Recombinant Rat Beta Defensin -3

BD 4 cyt-599 Recombinant Human Beta Defensin -4

rBD 4 cyt-066 Recombinant Rat Beta Defensin -4

BDNF cyt-207 Recombinant Human Brain-Derived Neurotrophic Factor

proBDNF cyt-014 Recombinant Human Precursor Brain-Derived Neurotrophic Factor

BAFF cyt-307 Recombinant Human BAFF (BLyS)

BAFF His cyt-545 Recombinant Human BAFF (BLyS), His Tag

BAFF Plant cyt-054 Recombinant Human BAFF (BLyS), Plant

BAFF R cyt-429 Recombinant Human BAFF (BLyS) Receptor

BMPR1A cyt-380 Recombinant Human Bone Morphogenetic protein Receptor-1A

BMPR1A HEK cyt-713 Recombinant Human Bone Morphogenetic protein Receptor-1A HEK

BMP 2 cyt-261 Recombinant Human Bone Morphogenetic protein-2

BMP 2 HEK cyt-080 Recombinant Human Bone Morphogenetic protein-2, HEK

BMP 2 Mono cyt-627 Recombinant Human Bone Morphogenetic protein-2 Monomer

Pro BMP 2 cyt-427 Recombinant Human Pro Bone Morphogenetic protein-2

BMP 4 cyt-361 Recombinant Human Bone Morphogenetic protein-4

BMP 4 Active cyt-081 Recombinant Human Bone Morphogenetic protein-4 Active

BMP 5 cyt-660 Recombinant Human Bone Morphogenetic protein-5

BMP 7 cyt-333 Recombinant Human Bone Morphogenetic protein-7

BMP 7 His cyt-629 Recombinant Human Bone Morphogenetic protein-7 His Tag

BMP 7 CHO cyt-276 Recombinant Human Bone Morphogenetic protein-7, CHO

BMP 7 Plant cyt-039 Recombinant Human Bone Morphogenetic protein-7, Plant

BMP 7 HEK cyt-082 Recombinant Human Bone Morphogenetic protein-7, HEK

b NGF cyt-579 Recombinant Human beta Nerve Growth Factor

b NGF CHO cyt-246 Recombinant Human beta Nerve Growth Factor, CHO

b NGF HEK cyt-079 Recombinant Human beta Nerve Growth Factor, HEK

mb NGF cyt-581 Recombinant Mouse beta Nerve Growth Factor

mb NGF cyt-440 Mouse beta Nerve Growth Factor

ProNGF cyt-426 Recombinant Human Pro-Nerve Growth Factor

BNP cyt-327 Recombinant Human B-type Natriuretic Protein

BNP His cyt-605 Recombinant Human B-type Natriuretic Protein His Tag

BNP cyt-369 Human B-type Natriuretic Protein

BST2 cyt-059 Recombinant Human Bone Marrow Stromal Cell Antigen 2

BTC cyt-330 Recombinant Human Betacellulin

BTC His cyt-077 Recombinant Human Betacellulin, His Tag

mBTC cyt-131 Recombinant Mouse Betacellulin

bBTC cyt-406 Recombinant Bovine Betacellulin

CDNF cyt-167 Recombinant Human Cerebral Dopamine Neurotrophic Factor

mCDNF cyt-729 Recombinant Mouse Cerebral Dopamine Neurotrophic Factor

rCDNF cyt-730 Recombinant Rat Cerebral Dopamine Neurotrophic Factor

CLCF1 cyt-071 Recombinant Human Cardiotrophin-Like Cytokine Factor 1

CNTF cyt-272 Recombinant Human Ciliary Neurotrophic Factor

CNTF His cyt-573 Recombinant Human Ciliary Neurotrophic Factor, His Tag

mCNTF cyt-139 Recombinant Mouse Ciliary Neurotrophic Factor

rCNTF cyt-654 Recombinant Rat Ciliary Neurotrophic Factor

CT 1 cyt-436 Recombinant Human Cardiotrophin-1

mCT 1 cyt-151 Recombinant Mouse Cardiotrophin-1

rCT 1 cyt-199 Recombinant Rat Cardiotrophin-1

CTGF cyt-541 Recombinant Human Connective Tissue Growth Factor

CTGF His cyt-438 Recombinant Human Connective Tissue Growth Factor, His Tag

CTGF (182-250 a.a.) cyt-526 Recombinant Human Connective Tissue Growth Factor 182-250 a.a.

CTGF HEK cyt-687 Recombinant Human Connective Tissue Growth Factor, HEK

CTLA 4 cyt-366 Recombinant Human Cytotoxic T-Lymphocyte Associated Antigen-4

CYR61 cyt-164 Recombinant Human Cysteine-Rich Angiogenic Inducer 61

EBI3 cyt-367 Recombinant Human Epstein Barr Virus Induced 3

EBI3 His cyt-668 Recombinant Human Epstein Barr Virus Induced 3, His Tag

mEBI3 cyt-621 Recombinant Mouse Epstein Barr Virus Induced 3

EG VEGF cyt-338 Recombinant Human Endocrine Gland Vacular Endothelial Growth Factor

EGF cyt-217 Recombinant Human Epidermal Growth Factor

EGF Pichia cyt-332 Recombinant Human Epidermal Growth Factor, Pichia

EGF (Leu 21) cyt-466 Recombinant Human Epidermal Growth Factor 21-Leu

mEGF cyt-326 Recombinant Mouse Epidermal Growth Factor

mEGF cyt-554 Mouse Epidermal Growth Factor

mEGF, His cyt-138 Recombinant Mouse Epidermal Growth Factor, His

rEGF cyt-556 Rat Epidermal Growth Factor

rEGF cyt-669 Recombinant Rat Epidermal Growth Factor

EMAP II cyt-607 Recombinant Human Endothelial-Monocyte Activating Polypeptide II

AIMP1 cyt-021 Recombinant Human Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1

Endoglin Sf9 cyt-389 Recombinant Human Endoglin, Sf9

Endoglin cyt-525 Recombinant Human Endoglin

mEndoglin cyt-424 Recombinant Mouse Endoglin

EPGN cyt-601 Recombinant Human Epigen

EREG cyt-609 Recombinant Human Epiregulin

EPO a cyt-201 Recombinant Human Erythropoietin-alpha

EPO a Fc cyt-325 Recombinant Human Erythropoietin-alpha Fc/Chimera

EPO a HEK cyt-083 Recombinant Human Erythropoietin-alpha, HEK

FAS cyt-125 Recombinant Human sFas Receptor

FASLG cyt-031 Recombinant Human FAS Ligand

FASLG HEK cyt-051 Recombinant Human FAS Ligand, HEK

FGF 1 cyt-264 Recombinant Human Fibroblast Growth Factor-acidic

FGF 1 Sf9 cyt-364 Recombinant Human Fibroblast Growth Factor-acidic, Sf9

mFGF 1 cyt-528 Recombinant Mouse Fibroblast Growth Factor-acidic

mFGF 1 His cyt-072 Recombinant Mouse Fibroblast Growth Factor-acidic, His Tag

rFGF 1 cyt-075 Recombinant Rat Fibroblast Growth Factor-acidic

baFGF cyt-613 Bovine Fibroblast Growth Factor-acidic

FGF 2 cyt-218 Recombinant Human Fibroblast Growth Factor-basic

FGF 2 Sf9 cyt-365 Recombinant Human Fibroblast Growth Factor-basic, Sf9

FGF 2 (147 a.a.) cyt-557 Recombinant Human Fibroblast Growth Factor-basic (147 a.a)

FGF 2 293 Cells cyt-085 Recombinant Human Fibroblast Growth Factor-basic, 293 Cells

FGF2 Plant cyt-123 Recombinant Human Fibroblast Growth Factor-basic, Plant

bFGF 2 cyt-288 Recombinant Bovine Fibroblast Growth Factor-basic

bFGF 2 cyt-560 Bovine Fibroblast Growth Factor-basic

mFGF 2 cyt-386 Recombinant Mouse Fibroblast Growth Factor-basic

rFGF 2 cyt-608 Recombinant Rat Fibroblast Growth Factor-basic

FGF 4 cyt-312 Recombinant Human Fibroblast Growth Factor-4

FGF 4 HEK cyt-084 Recombinant Human Fibroblast Growth Factor-4, HEK

FGF 8 cyt-714 Recombinant Human Fibroblast Growth Factor-8

mFGF 8 cyt-070 Recombinant Mouse Fibroblast Growth Factor-8

FGF 8 HEK cyt-087 Recombinant Human Fibroblast Growth Factor-8, HEK

FGF 9 cyt-415 Recombinant Human Fibroblast Growth Factor-9

mFGF 9 cyt-349 Recombinant Mouse Fibroblast Growth Factor-9

rFGF 9 cyt-558 Recombinant Rat Fibroblast Growth Factor-9

FGF12 cyt-620 Recombinant Human Fibroblast Growth Factor 12

FGF13 cyt-121 Recombinant Human Fibroblast Growth Factor 13

mFGF-15 cyt-027 Recombinant Mouse Fibroblast Growth Factor-15

FGF-18 cyt-120 Recombinant Human Fibroblast Growth Factor-18

mFGF-18 cyt-064 Recombinant Mouse Fibroblast Growth Factor-18

rFGF-18 cyt-176 Recombinant Rat Fibroblast Growth Factor-18

FGF 19 cyt-700 Recombinant Human Fibroblast Growth Factor-19

FGF 19 His cyt-279 Recombinant Human Fibroblast Growth Factor-19 His Tag

FGF 21 cyt-474 Recombinant Human Fibroblast Growth Factor-21

FGF 21 His cyt-281 Recombinant Human Fibroblast Growth Factor-21, His Tag

mFGF 21 cyt-339 Recombinant Mouse Fibroblast Growth Factor-21

mFGF 21 His cyt-516 Recombinant Mouse Fibroblast Growth Factor-21, His Tag

rFGF 21 cyt-130 Recombinant Rat Fibroblast Growth Factor-21

bFGF 21 cyt-657 Recombinant Bovine Fibroblast Growth Factor-21

FGF 22 cyt-428 Recombinant Human Fibroblast Growth Factor-22

FGF 23 cyt-020 Recombinant Human Fibroblast Growth Factor-23

FGF 23 His cyt-374 Recombinant Human Fibroblast Growth Factor-23 His Tag

FGF 23 C-term cyt-028 Recombinant Human Fibroblast Growth Factor-23 C-Terminal

Flt3 Ligand cyt-331 Recombinant Human Flt3-Ligand

Flt3 Ligand HEK cyt-706 Recombinant Human Flt3-Ligand, HEK

Flt3 Ligand Sf9 cyt-409 Recombinant Human Flt3-Ligand, Sf9

mFlt3 Ligand cyt-340 Recombinant Mouse Flt3-Ligand

rmFlt3 Ligand cyt-157 Recombinant Rhesus Macaque Flt3-Ligand

FST cyt-232 Recombinant Human Follistatin

FST His cyt-029 Recombinant Human Follistatin His Tag

mFST cyt-124 Recombinant Mouse Follistatin

HB-EGF cyt-119 Recombinant Human Proheparin-Binding EGF-like Growth Factor

mHB-EGF cyt-068 Recombinant Mouse Proheparin-Binding EGF-like Growth Factor

rHB-EGF cyt-170 Recombinant Rat Proheparin-Binding EGF-like Growth Factor

LGALS1 cyt-544 Recombinant Human Galectin-1

mLGALS1 cyt-186 Recombinant Mouse Galectin-1

LGALS2 cyt-725 Recombinant Human Galectin-2

mLGALS2 cyt-019 Recombinant Mouse Galectin-2

LGALS3 cyt-606 Recombinant Human Galectin-3

LGALS3 His cyt-693 Recombinant Human Galectin-3 His Tag

mLGALS3 cyt-188 Recombinant Mouse Galectin-3

LGALS4 cyt-686 Recombinant Human Galectin-4

mLGALS4 cyt-187 Recombinant Mouse Galectin-4

LGALS7 cyt-016 Recombinant Human Galectin-7

LGALS7 His cyt-617 Recombinant Human Galectin-7 His Tag

mLGALS7 cyt-184 Recombinant Mouse Galectin-7

LGALS8 cyt-017 Recombinant Human Galectin-8

LGALS8 His cyt-727 Recombinant Human Galectin-8, His Tag

mLGALS8 cyt-185 Recombinant Mouse Galectin-8

LGALS9 cyt-708 Recombinant Human Galectin-9

mLGALS9 cyt-550 Recombinant Mouse Galectin-9

LGALS13 cyt-004 Recombinant Human Galectin-13

LGALS14 cyt-003 Recombinant Human Galectin-14

LGALSL cyt-073 Recombinant Human Galectin-Related Protein

GDNF cyt-305 Recombinant Human Glial-Derived Neurotrophic Factor

GDF3 cyt-694 Recombinant Human Growth and Differentiation factor 3

GDF5 cyt-442 Recombinant Human Growth and Differentiation factor 5

GDF5 His cyt-653 Recombinant Human Growth and Differentiation factor 5 His Tag

GDF10 cyt-659 Recombinant Human Growth and Differentiation factor 10

GDF15 His cyt-691 Recombinant Human Growth and Differentiation factor 15, His Tag

GDF15 D cyt-314 Recombinant Human Growth and Differentiation factor 15 D-Vairant

GDF15 cyt-335 Recombinant Human Growth and Differentiation factor 15

G CSF cyt-220 Recombinant Human Granulocyte-Colony Stimulating Factor

G CSF His cyt-476 Recombinant Human Granulocyte-Colony Stimulating Factor, His Tag

G CSF CHO cyt-329 Recombinant Human Granulocyte-Colony Stimulating Factor, CHO

G CSF PEG cyt-018 Recombinant Human Pegylated Granulocyte-Colony Stimulating Factor

G CSF HEK cyt-088 Recombinant Human Granulocyte-Colony Stimulating Factor, HEK

mG CSF cyt-410 Recombinant Mouse Granulocyte-Colony Stimulating Factor

GH cyt-202 Recombinant Human Growth Hormone

pGH 22kDa cyt-235 Recombinant Human Placental Corr Growth Hormone

GH 20kDa cyt-259 Recombinant Human Pituitary Growth Hormone 20kDa

pGH 20kDa cyt-337 Recombinant Human Placental Growth Hormone 20kDa

GH Plant cyt-053 Recombinant Human Growth Hormone, Plant

GH HEK cyt-091 Recombinant Human Growth Hormone, HEK

GHBP cyt-238 Recombinant Human Growth Hormone Binding Protein

oGHBP cyt-470 Recombinant Ovine Growth Hormone Binding Protein

bGHBP cyt-471 Recombinant Bovine Growth Hormone Binding Protein

raGHBP cyt-593 Recombinant Rabbit Growth Hormone Binding Protein

chGH cyt-430 Recombinant Chicken Growth Hormone

oGH cyt-237 Recombinant Ovine Growth Hormone

oGH Placental cyt-594 Recombinant Placental Ovine Growth Hormone

bGH cyt-636 Recombinant Bovine Growth Hormone

mGH cyt-540 Recombinant Mouse Growth Hormone

rGH cyt-296 Recombinant Rat Growth Hormone

cGH cyt-297 Recombinant Carp Growth Hormone

dGH cyt-498 Recombinant Denis Growth Hormone

maiGH cyt-499 Recombinant Mai Mai Growth Hormone

sGH cyt-529 Recombinant Gilthead Seabream Growth Hormone

raGH cyt-514 Recombinant Rabbit Growth Hormone

pGH cyt-519 Recombinant Porcine Growth Hormone

chGH Antagonist cyt-538 Recombinant Chicken Growth Hormone Anatagonist

oGH Antagonist cyt-215 Recombinant Ovine Growth Hormone Anatagonist

zGH cyt-710 Recombinant Zebrafish Growth Hormone

zGH Mutant cyt-709 Recombinant Zebrafish Growth Hormone Mutant

GM CSF cyt-221 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor

GM CSF Pichia cyt-324 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Pichia

GM CSF Sf9 cyt-416 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Sf9

GM CSF HEK cyt-089 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, HEK

GM CSF His cyt-477 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, His Tag

PIXY321 cyt-360 Recombinant Human gm-csf/IL-3 Fusion Protein (PIXY321)

mGM CSF cyt-222 Recombinant Mouse Granulocyte Macrophage-Colony Stimulating Factor

rGM CSF cyt-395 Recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor

pGM CSF cyt-401 Recombinant Porcine Granulocyte Macrophage-Colony Stimulating Factor

rmGM CSF cyt-720 Recombinant Rhesus Macaque Granulocyte Macrophage-Colony Stimulating Factor

k9GM CSF cyt-724 Recombinant Canine Granulocyte Macrophage-Colony Stimulating Factor

GMF b cyt-565 Recombinant Human Glia Maturation Factor Beta

GMF b His cyt-726 Recombinant Human Glia Maturation Factor Beta His Tag

mGMF b cyt-006 Recombinant Mouse Glia Maturation Factor Beta

rGMF b cyt-049 Recombinant Rat Glia Maturation Factor Beta

GMFG cyt-632 Recombinant Human Glia Maturation Factor Gamma

HDGF cyt-681 Recombinant Human Hepatoma-Derived Growth Factor

HDGF2 cyt-132 Recombinant Human Hepatoma-Derived Growth Factor-2

HGF CHO cyt-251 Recombinant Human Hepatocyte Growth Factor, CHO

HGF Sf9 cyt-244 Recombinant Human Hepatocyte Growth Factor, Sf9

HGF HEK cyt-090 Recombinant Human Hepatocyte Growth Factor, HEK

HGF-A cyt-664 Recombinant Human Hepatocyte Growth Factor A Chain

HGF-B cyt-665 Recombinant Human Hepatocyte Growth Factor B Chain

pHGF cyt-522 Porcine Hepatocyte Promoting Growth Factor

IFI30 cyt-183 Recombinant Human Interferon Gamma-Inducible protein 30

IFN a 1 cyt-291 Recombinant Human Interferon-alpha 1

IFN a 1a cyt-520 Recombinant Human Interferon-alpha 1a

IFN a 1b cyt-283 Recombinant Human Interferon-alpha 1b

IFN a 2a cyt-204 Recombinant Human Interferon-alpha 2a

IFN a 2a Plant cyt-543 Recombinant Human Interferon-alpha 2a, Tobacco

IFN a 2b cyt-205 Recombinant Human Interferon-alpha 2b

IFN a 2b Yeast cyt-460 Recombinant Human Interferon-alpha 2b, Saccharomyces

IFN a 2b 20kd-PEG cyt-034 Recombinant Human Interferon-alpha 2b 20kd-Pegylated

IFN a 2b HEK cyt-092 Recombinant Human Interferon-alpha 2b, HEK

IFN a 2a HEK cyt-093 Recombinant Human Interferon-alpha 2a, HEK

IFNA7 cyt-196 Recombinant Human Interferon-alpha 7

IFNA14 cyt-135 Recombinant Human Interferon-alpha 14

IFN b 1a cyt-236 Recombinant Human Interferon-beta 1a

IFN b 1b cyt-234 Recombinant Human Interferon-beta 1b

mIFN b His cyt-651 Recombinant Mouse Interferon-beta His Tag

IFN g cyt-206 Recombinant Human Interferon-gamma

IFN g His cyt-478 Recombinant Human Interferon-gamma His Tag

mIFN g cyt-358 Recombinant Mouse Interferon-gamma

rIFN g cyt-359 Recombinant Rat Interferon-gamma

pIFN g cyt-402 Recombinant Porcine Interferon-gamma

qIFN g cyt-739 Recombinant Equine Interferon-gamma

IFNW1 cyt-040 Recombinant Human Interferon-Omega 1

oIFN tau cyt-377 Recombinant Ovine Interferon-Tau

IRF 1 cyt-449 Recombinant Human Interferon Regulatory Factor-1

IRF 2 cyt-534 Recombinant Human Interferon Regulatory Factor-2

IRF 3 cyt-292 Recombinant Human Interferon Regulatory Factor-3

IGF1 cyt-216 Recombinant Human Insulin Like Growth Factor-1

IGF1 GST cyt-690 Recombinant Human Insulin Like Growth Factor-1, GST-Tag

IGF1 Des1-3 cyt-518 Recombinant Human Insulin Like Growth Factor-1 Des (1-3)

Long R3 IGF1 cyt-022 Recombinant Human LR3 Insulin Like Growth Factor-1

IGF1 N15 cyt-128 Recombinant Human Insulin Like Growth Factor-1 N15 Labeled

mIGF1 cyt-229 Recombinant Mouse Insulin Like Growth Factor-1

rIGF1 cyt-289 Recombinant Rat Insulin Like Growth Factor-1

sIGF1 cyt-295 Recombinant Gilthead Seabream Insulin Like Growth Factor-1

IGF2 cyt-265 Recombinant Human Insulin Like Growth Factor-2

pro-IGF2 cyt-110 Recombinant Human Pro-Insulin Like Growth Factor-2

IGFBP 1 cyt-299 Human Insulin Like Growth Factor Binding Protein-1

IGFBP 3 cyt-300 Recombinant Human Insulin Like Growth Factor Binding Protein-3

IGFBP 4 cyt-030 Recombinant Human Insulin Like Growth Factor Binding Protein-4

IGFBP 5 cyt-464 Recombinant Human Insulin Like Growth Factor Binding Protein-5

IGFBP 6 cyt-258 Recombinant Human Insulin Like Growth Factor Binding Protein-6

IHH cyt-195 Recombinant Human Indian Hedgehog

IL 1 alpha cyt-253 Recombinant Human Interleukin-1 alpha

IL 1 alpha His cyt-479 Recombinant Human Interleukin-1 alpha, His Tag

mIL 1 alpha cyt-523 Recombinant Mouse Interleukin-1 alpha

rIL 1 alpha cyt-381 Recombinant Rat Interleukin-1 alpha

pIL 1 alpha cyt-396 Recombinant Porcine Interleukin-1 alpha

IL 1 beta cyt-208 Recombinant Human Interleukin-1 beta

IL 1 beta His cyt-480 Recombinant Human Interleukin-1 beta, His Tag

IL 1 beta HEK cyt-094 Recombinant Human Interleukin-1 beta, HEK

mIL 1 beta cyt-273 Recombinant Mouse Interleukin-1 beta

mIL 1 beta His cyt-578 Recombinant Mouse Interleukin-1 beta, His Tag

rIL 1 beta cyt-394 Recombinant Rat Interleukin-1 beta

pIL 1 beta cyt-400 Recombinant Porcine Interleukin-1 beta

rmIL 1 beta cyt-718 Recombinant Rhesus Macaque Interleukin-1 beta

IL 1RA cyt-203 Recombinant Human Interleukin-1 Receptor Antagonist

IL 1RA His cyt-481 Recombinant Human Interleukin-1 Receptor Antagonist, His Tag

IL1RL1 cyt-671 Recombinant Human Interleukin-1 Receptor Like-1

mIL 1RA cyt-658 Recombinant Mouse Interleukin-1 Receptor Antagonist

mIL 1RA His cyt-136 Recombinant Mouse Interleukin-1 Receptor Antagonist, His Tag

rIL 1RA cyt-152 Recombinant Rat Interleukin-1 Receptor Antagonist

hIL 1RA cyt-010 Recombinant Horse Interleukin-1 Receptor Antagonist

IL 2 cyt-209 Recombinant Human Interleukin-2

IL 2 His cyt-666 Recombinant Human Interleukin-2 His Tag

IL 2 HEK cyt-095 Recombinant Human Interleukin 2, HEK

mIL 2 cyt-370 Recombinant Mouse Interleukin-2

mIL 2 His cyt-624 Recombinant Mouse Interleukin-2, His Tag

rIL 2 cyt-382 Recombinant Rat Interleukin-2

pIL 2 cyt-397 Recombinant Porcine Interleukin-2

qIL2 cyt-738 Recombinant Equine Interleukin-2

sIL 2R cyt-285 Recombinant Human Soluble Iinterleukin-2 Receptor alpha

IL 3 cyt-210 Recombinant Human Interleukin-3

IL 3 His cyt-482 Recombinant Human Interleukin-3, His Tag

IL 3 HEK cyt-096 Recombinant Human Interleukin 3, HEK

mIL 3 cyt-371 Recombinant Mouse Interleukin-3

rIL 3 cyt-383 Recombinant Rat Interleukin-3

IL 3 Sf9 cyt-417 Recombinant Human Interleukin-3, Sf9

k9 IL 3 cyt-722 Recombinant Canine Interleukin-3

rmIL3 cyt-156 Recombinant Rhesus Macaque Interleukin-3

IL 4 cyt-211 Recombinant Human Interleukin-4

IL 4 CHO cyt-271 Recombinant Human Interleukin-4 CHO

IL 4 His cyt-483 Recombinant Human Interleukin-4, His Tag

IL 4 HEK cyt-097 Recombinant Human Interleukin 4, HEK

mIL 4 cyt-282 Recombinant Mouse Interleukin-4

rIL 4 cyt-385 Recombinant Rat Interleukin-4

pIL 4 cyt-398 Recombinant Porcine Interleukin-4

rmIL4 cyt-172 Recombinant Rhesus Macaque Interleukin-4

IL 5 cyt-212 Recombinant Human Interleukin-5

mIL 5 cyt-689 Recombinant Mouse Interleukin-5

rIL 5 cyt-387 Recombinant Rat Interleukin-5

IL 6 cyt-213 Recombinant Human Interleukin-6

IL 6 CHO cyt-274 Recombinant Human Interleukin-6, CHO

IL 6 His cyt-484 Recombinant Human Interleukin-6, His Tag

IL 6 HEK cyt-098 Recombinant Human Interleukin 6, HEK

mIL 6 cyt-350 Recombinant Mouse Interleukin-6

rIL 6 cyt-388 Recombinant Rat Interleukin-6

pIL 6 cyt-399 Recombinant Porcine Interleukin-6

rmIL 6 cyt-174 Recombinant Rhesus Macaque Interleukin-6

sIL 6R cyt-286 Recombinant Human Soluble IL-6 Receptor alpha

IL 7 cyt-254 Recombinant Human Interleukin-7

IL 7 Yeast cyt-298 Recombinant Human Interleukin-7, Saccharomyces

IL 7 His cyt-485 Recombinant Human Interleukin-7, His Tag

IL 7, HEK cyt-197 Recombinant Human Interleukin-7, HEK

mIL 7 cyt-372 Recombinant Mouse Interleukin-7

rIL 7 cyt-163 Recombinant Rat Interleukin-7

IL 9 cyt-348 Recombinant Human Interleukin-9

IL 9 HEK cyt-099 Recombinant Human Interleukin 9, HEK

mIL 9 cyt-373 Recombinant Mouse Interleukin-9

rIL 9 cyt-748 Recombinant Rat Interleukin-9

IL 10 cyt-500 Recombinant Human Interleukin-10

IL 10 His cyt-486 Recombinant Human Interleukin-10, His Tag

IL 10 HEK cyt-100 Recombinant Human Interleukin 10, HEK

mIL 10 cyt-497 Recombinant Mouse Interleukin-10

rIL 10 cyt-465 Recombinant Rat Interleukin-10

pIL 10 cyt-404 Recombinant Porcine Interleukin-10

IL 11 cyt-214 Recombinant Human Interleukin-11

IL 11 Pichia cyt-013 Recombinant Human Interleukin-11, Pichia

mIL 11 cyt-646 Recombinant Mouse Interleukin-11

IL 12 cyt-101 Recombinant Human Interleukin 12

IL 12 p35 His cyt-487 Recombinant Human Interleukin-12 p35, His Tag

IL 12 p40 Baculovirus cyt-134 Recombinant Human Interleukin-12 p40, Baculovirus

IL 12 p40 His cyt-488 Recombinant Human Interleukin-12 p40, His Tag

IL 12 p40 Plant cyt-056 Recombinant Human Interleukin-12 p40, Plant

mIL 12 cyt-144 Recombinant Mouse Interleukin-12

rIL 12 cyt-390 Recombinant Rat Interleukin-12

IL 13 cyt-446 Recombinant Human Interleukin-13

IL 13 Variant cyt-682 Recombinant Human Interleukin-13 Variant

IL 13 His cyt-489 Recombinant Human Interleukin-13, His Tag

mIL 13 cyt-375 Recombinant Mouse Interleukin-13

rIL 13 cyt-391 Recombinant Rat Interleukin-13

rIL 13 109 a.a. cyt-182 Recombinant Rat Interleukin-13 109 a.a.

rmIL 13 cyt-175 Recombinant Rhesus Macaque Interleukin-13

IL 15 cyt-230 Recombinant Human Interleukin-15

IL 15 His cyt-490 Recombinant Human Interleukin-15, His Tag

mIL 15 cyt-344 Recombinant Mouse Interleukin-15

mIL 15 His cyt-647 Recombinant Mouse Interleukin-15, His Tag

rIL 15 cyt-345 Recombinant Rat Interleukin-15

pIL 15 cyt-403 Recombinant Porcine Interleukin-15

IL 16, (130 a.a.) cyt-536 Recombinant Human Interleukin-16, (130 a.a.)

IL 16, (121 a.a.) cyt-142 Recombinant Human Interleukin-16, (121 a.a.)

IL 16 His cyt-562 Recombinant Human Interleukin-16, His Tag

mIL 16 cyt-559 Recombinant Mouse Interleukin-16

maIL 16 cyt-153 Recombinant Rhesus Macaque Interleukin-16

IL 17A cyt-250 Recombinant Human Interleukin-17A

IL 17A His cyt-662 Recombinant Human Interleukin-17A His Tag

IL 17A HEK cyt-102 Recombinant Human Interleukin 17A, HEK

IL 17E cyt-583 Recombinant Human Interleukin-17E

IL 17F cyt-587 Recombinant Human Interleukin-17F

IL 17F HEK cyt-103 Recombinant Human Interleukin 17F, HEK

IL 17 A/F cyt-623 Recombinant Human Interleukin-17 A/F Heterodimer

mIL 17 cyt-378 Recombinant Mouse Interleukin-17A

mIL 17E cyt-641 Recombinant Mouse Interleukin-17E

mIL 17F cyt-642 Recombinant Mouse Interleukin-17F

mIL 17 A/F cyt-640 Recombinant Mouse Interleukin-17 A/F Heterodimer

rIL 17 A/F cyt-677 Recombinant Rat Interleukin-17 A/F Heterodimer

rIL 17 cyt-542 Recombinant Rat Interleukin-17A

rIL 17E cyt-576 Recombinant Rat Interleukin-17E

rIL 17F cyt-643 Recombinant Rat Interleukin-17F

IL 18 cyt-269 Recombinant Human Interleukin-18

IL 18 His cyt-663 Recombinant Human Interleukin-18 His Tag

IL18BP cyt-728 Recombinant Human Interleukin-18 Binding Protein

mIL 18 cyt-634 Recombinant Mouse Interleukin-18

rIL 18 cyt-376 Recombinant Rat Interleukin-18

IL 19 cyt-363 Recombinant Human Interleukin-19

mIL 19 cyt-411 Recombinant Mouse Interleukin-19

IL 20 cyt-347 Recombinant Human Interleukin-20

mIL 20 cyt-379 Recombinant Mouse Interleukin-20

IL 21 cyt-408 Recombinant Human Interleukin-21

mIL 21 cyt-684 Recombinant Mouse Interleukin-21

rIL 21 cyt-033 Recombinant Rat Interleukin-21

IL 22 cyt-328 Recombinant Human Interleukin-22

mIL 22 cyt-539 Recombinant Mouse Interleukin-22

rIL 22 cyt-173 Recombinant Rat Interleuikin-22

mIL 22 PEG cyt-701 Recombinant Mouse Interleukin-22, Pegylated

mIL 22A cyt-148 Recombinant Mouse Interleukin-22 Antagonist (E117A)

IL 23 cyt-050 Recombinant Human Interleukin-23

IL 23 His cyt-067 Recombinant Human Interleukin-23, His Tag

IL 24 cyt-515 Recombinant Human Interleukin-24

IL 27 cyt-048 Recombinant Human Interleukin-27 p28

mIL 27 cyt-570 Recombinant Mouse Interleukin-27

IL 28A cyt-602 Recombinant Human Interleukin-28A

IL 28A HEK cyt-104 Recombinant Human Interleukin-28A, HEK

mIL 28A cyt-741 Recombinant Mouse Interleukin-28A

IL 28B cyt-105 Recombinant Human Interleukin-28B

mIL 28B cyt-732 Recombinant Mouse Interleukin-28B

IL 29 cyt-603 Recombinant Human Interleukin-29

IL 29 HEK cyt-117 Recombinant Human Interleukin-29, HEK

IL 31 cyt-625 Recombinant Human Interleukin-31

mIL 31 cyt-604 Recombinant Mouse Interleukin-31

IL 32A cyt-584 Recombinant Human IL-32 alpha

IL 32A His Tag cyt-648 Recombinant Human IL-32 alpha His Tag

IL 33 cyt-425 Recombinant Human Interleukin-33

IL 33 His cyt-667 Recombinant Human Interleukin-33 His Tag

mIL 33 cyt-655 Recombinant Mouse Interleukin-33

rIL 33 cyt-150 Recombinant Rat Interleukin-33

IL34 cyt-042 Recombinant Human Interleukin-34

IL36RN cyt-009 Recombinant Human Interleukin-36 Receptor Antagonist

mIL36RN cyt-154 Recombinant Mouse Interleukin-36 Receptor Antagonist

IL36A cyt-158 Recombinant Human Interleukin-36 Alpha

IL36A 158 a.a. cyt-179 Recombinant Human Interleukin-36 Alpha 158 a.a.

mIL36A cyt-162 Recombinant Mouse Interleukin-36 Alpha

mIL36A 153 a.a. cyt-181 Recombinant Mouse Interleukin-36 Alpha 153 a.a.

IL36B cyt-159 Recombinant Human Interleukin-36 Beta

IL36B 153 a.a. cyt-180 Recombinant Human Interleukin-36 Beta 153 a.a

mIL36B cyt-165 Recombinant Mouse Interleukin-36 Beta

IL36G cyt-160 Recombinant Human Interleukin-36 Gamma

IL36G 152 a.a. cyt-161 Recombinant Human Interleukin-36 Gamma 152 a.a.

mIL36G cyt-745 Recombinant Mouse Interleukin-36 Gamma

IL37 cyt-011 Recombinant Human Interleukin 37

IL1F10 cyt-012 Recombinant Human Interleukin 1 Family, Member 10

Insulin cyt-270 Recombinant Human Insulin

Insulin Yeast cyt-614 Recombinant Human Insulin Yeast

pInsulin cyt-468 Porcine Insulin

KGF cyt-219 Recombinant Human Keratinocyte Growth Factor

mKGF cyt-721 Recombinant Mouse Keratinocyte Growth Factor

KGF HEK cyt-086 Recombinant Human Keratinocyte Growth Factor, HEK

KGF 2 cyt-303 Recombinant Human Keratinocyte Growth Factor-2

KGF 2 His cyt-129 Recombinant Human Keratinocyte Growth Factor-2, His Tag

mKGF 2 cyt-126 Recombinant Mouse Keratinocyte Growth Factor-2

rKGF cyt-127 Recombinant Rat Keratinocyte Growth Factor-2

Leptin cyt-228 Recombinant Human Leptin

Leptin cyt-683 Human Leptin

Leptin His cyt-287 Recombinant Human Leptin, His Tag

mLeptin cyt-351 Recombinant Mouse Leptin

mLeptin PEG cyt-591 Recombinant Pegylated Mouse Leptin

rLeptin cyt-227 Recombinant Rat Leptin

rLeptin PEG cyt-592 Recombinant Pegylated Rat Leptin

oLeptin cyt-239 Recombinant Ovine Leptin

oLeptin, MTS cyt-531 Recombinant Ovine Leptin, MTS tag

bLeptin cyt-502 Recombinant Bovine Leptin

pLeptin cyt-503 Recombinant Porcine Leptin

pfLeptin cyt-530 Recombinant Pufferfish Leptin

sLeptin cyt-704 Recombinant Salamander Leptin

hLeptin cyt-504 Recombinant Horse Leptin

chLeptin cyt-505 Recombinant Chicken Leptin

dLeptin cyt-506 Recombinant Dog Leptin

raLeptin cyt-507 Recombinant Rabbit Leptin

Leptin tA cyt-352 Recombinant Human Leptin Triple Antagonist

Leptin tA PEG cyt-702 Recombinant Human Leptin Triple Antagonist, Pegylated

Leptin qA cyt-353 Recombinant Human Leptin Quadruple Antagonist

mLeptin tA cyt-354 Recombinant Mouse Leptin Triple Antagonist

mLeptin tA PEG cyt-566 Recombinant Pegylated Mouse Leptin Triple Antagonist, Pegylated

rLeptin tA cyt-355 Recombinant Rat Leptin Triple Antagonist

rLeptin tA PEG cyt-567 Recombinant Pegylated Rat Leptin Triple Antagonist, Pegylated

oLeptin tA cyt-356 Recombinant Ovine Leptin Triple Antagonist

oLeptin tA PEG cyt-703 Recombinant Ovine Leptin Triple Antagonist, Pegylated

oLeptin qA cyt-357 Recombinant Ovine Leptin Quadruple Antagonist

Leptin Receptor cyt-508 Recombinant Human Leptin Binding Domain

chLeptin Receptor cyt-509 Recombinant Chicken Leptin Binding Domain

LFA 3 cyt-423 Recombinant Human Leukocyte Function Associated Antigen-3 Fusion Protein

LIF cyt-644 Recombinant Human Leukemia Inhibitory Factor

mLIF cyt-645 Recombinant Mouse Leukemia Inhibitory Factor

LIF GST cyt-001 Recombinant Human Leukemia Inhibitory Factor, GST tag

rLIF cyt-731 Recombinant Rat Leukemia Inhibitory Factor

MANF, His cyt-133 Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor, His Tag

MANF cyt-141 Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor

M CSF cyt-308 Recombinant Human Macrophage Colony Stimulating Factor

M CSF Baculovirus cyt-637 Recombinant Human Macrophage Colony Stimulating Factor, Baculovirus

M CSF HEK cyt-106 Recombinant Human Macrophage Colony Stimulating Factor, HEK

M CSF His cyt-695 Recombinant Human Macrophage Colony Stimulating Factor, His Tag

mM CSF cyt-439 Recombinant Mouse Macrophage Colony Stimulating Factor

rM CSF cyt-046 Recombinant Rat Macrophage Colony Stimulating Factor

MIF cyt-575 Recombinant Human Macrophage Migration Inhibitor Factor

MIF (Active) cyt-596 Recombinant Human Macrophage Migration Inhibitor Factor

MIF His N cyt-431 Recombinant Human Macrophage Migration Inhibitor Factor, His Tag N-Terminus

MIF His C cyt-521 Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus

mMIF cyt-744 Recombinant Mouse Macrophage Migration Inhibitor Factor

rMIF cyt-193 Recombinant Rat Macrophage Migration Inhibitor Factor

MIA cyt-310 Recombinant Human Melanoma Inhibitory Activity Protein

MIA2 cyt-638 Recombinant Human Melanoma Inhibitory Activity Protein 2

Midkine cyt-192 Recombinant Human Midkine

Midkine, His cyt-444 Recombinant Human Midkine, His Tag

mMidkine cyt-178 Recombinant Mouse Midkine

rMidkine cyt-747 Recombinant Rat Midkine

MTPN cyt-723 Recombinant Human Myotrophin

Myostatin cyt-418 Recombinant Human Myostatin

Myostatin His cyt-445 Recombinant Human Myostatin, His-Tag

Myostatin Propetide cyt-448 Recombinant Human Myostatin Propeptide

Myostatin Plant cyt-055 Recombinant Human Myostatin, Plant

NGB cyt-450 Recombinant Human Neuroglobin

NRG1 cyt-407 Recombinant Human Neuregulin-1/Heregulin-b2

NRG1 B1 cyt-733 Recombinant Human Neuregulin-1/Heregulin-b1

NRG1 A cyt-736 Recombinant Human Neuregulin-1/Heregulin Alpha (EGF Domain)

NT 3 cyt-257 Recombinant Human Neurotrophin-3

proNT3 cyt-015 Recombinant Human Precursor Neurotrophin-3

mNT 3 cyt-688 Recombinant Mouse Neurotrophin-3

NT 4 cyt-626 Recombinant Human Neurotrophin-4

Noggin cyt-475 Recombinant Human Noggin

Noggin HEK cyt-107 Recombinant Human Noggin, HEK

mNoggin cyt-600 Recombinant Mouse Noggin

Omentin cyt-301 Recombinant Human Omentin

Omentin His cyt-551 Recombinant Human Omentin His Tag

Omentin 298 a.a. cyt-061 Recombinant Human Omentin 298 a.a.

OPG Fc cyt-266 Recombinant Human Osteoprotegerin/Fc Chimera

OPG cyt-177 Recombinant Human Osteoprotegerin

OPG His cyt-290 Recombinant Human Osteoprotegerin, His Tag

OPG Hi-5 cyt-633 Recombinant Human Osteoprotegerin Hi-5

OSM cyt-231 Recombinant Human Oncostatin-M

OSM (209 a.a.) cyt-639 Recombinant Human Oncostatin-M (209 a.a.)

OSM (195 a.a.) cyt-735 Recombinant Human Oncostatin-M (195 a.a.)

OSM, His cyt-060 Recombinant Human Oncostatin-M, His Tag

OSM HEK cyt-108 Recombinant Human Oncostatin-M, HEK

mOSM cyt-168 Recombinant Mouse Oncostatin-M

rOSM cyt-169 Recombinant Rat Oncostatin-M

OSTF1 cyt-630 Recombinant Human Osteoclast Stimulating Factor-1

OTOR cyt-582 Recombinant Human Otoraplin

PDGF AA cyt-341 Recombinant Human Plaet Derived Growth Factor-AA

PDGF AA Yeast cyt-568 Recombinant Human Plaet Derived Growth Factor-AA, Yeast

PDGF AA HEK cyt-109 Recombinant Human Plaet Derived Growth Factor-AA HEK

PDGF A cyt-491 Recombinant Human Plaet Derived Growth Factor-A

mPDGF AA cyt-590 Recombinant Mouse Plaet Derived Growth Factor-AA

PDGF AB cyt-342 Recombinant Human Plaet Derived Growth Factor-AB

PDGF BB cyt-501 Recombinant Human Plaet Derived Growth Factor-BB

PDGF B cyt-492 Recombinant Human Plaet Derived Growth Factor-B

mPDGF BB cyt-412 Recombinant Mouse Plaet Derived Growth Factor-BB

rPDGF BB cyt-740 Recombinant Rat Plaet Derived Growth Factor-BB

PDGFD cyt-155 Recombinant Human Plaet Derived Growth Factor-D

PDGFRA cyt-065 Recombinant Human Plaet-Derived Growth Factor Receptor, Alpha

PEDF cyt-580 Recombinant Human Pigment Epithelium-Derived Factor

PEDF His cyt-552 Recombinant Human Pigment Epithelium-Derived Factor, His Tag

PEDF HEK cyt-553 Recombinant Human Pigment Epithelium-Derived Factor, HEK

Periostin cyt-452 Recombinant Human Periostin

PGRN cyt-524 Recombinant Human Progranulin

Pleiotrophin cyt-451 Recombinant Human Pleiotrophin

Pleiotrophin HEK cyt-198 Recombinant Human Pleiotrophin, HEK

Placental Lactogen cyt-656 Recombinant Human Placental Lactogen

bPlacental Lactogen cyt-511 Recombinant Bovine Placental Lactogen

oPlacental Lactogen cyt-512 Recombinant Ovine Placental Lactogen

cPlacental Lactogen cyt-510 Recombinant Caprine Placental Lactogen

PLGF 1 cyt-419 Recombinant Human Placenta Growth Factor-1

PLGF 2 cyt-420 Recombinant Human Placenta Growth Factor-2

Prolactin cyt-267 Recombinant Human Prolactin

Prolactin His cyt-493 Recombinant Human Prolactin, His Tag

mProlactin cyt-321 Recombinant Mouse Prolactin

rProlactin cyt-322 Recombinant Rat Prolactin

oProlactin cyt-240 Recombinant Ovine Prolactin

raProlactin cyt-513 Recombinant Rabbit Prolactin

Prl R, GST cyt-469 Recombinant Human Prolactin Receptor , GST Tag

Prl R cyt-595 Recombinant Human Prolactin Receptor

raPrl R cyt-268 Recombinant Rabbit Prolactin Soluble Receptor

oPrl R cyt-293 Recombinant Ovine Prolactin Soluble Receptor

bPrl R cyt-294 Recombinant Bovine Prolactin Soluble Receptor

tPrl R cyt-532 Recombinant Raibow Trout Prolactin Soluble Receptor

rPrl R cyt-533 Recombinant Rat Prolactin Soluble Receptor

oPrl A cyt-311 Recombinant Ovine Prolactin Antagonist

oPrl A Mutant cyt-705 Recombinant Ovine Prolactin Antagonist, Mutant

sCD4 cyt-304 Recombinant Human Soluble CD4

CD4 (26-226) cyt-313 Recombinant Human CD4 (26-226)

CD4 (125-202) cyt-315 Recombinant Human CD4 (125-202)

CD4 (203-317) cyt-316 Recombinant Human CD4 (203-317)

sCD40L cyt-245 Recombinant Human soluble CD40 Ligand/TRAP

sCD40L His cyt-670 Recombinant Human soluble CD40 Ligand/TRAP His Tag

msCD40L cyt-472 Recombinant Mouse soluble CD40 Ligand/TRAP

SCGB1A1 cyt-743 Recombinant Human Uteroglobin

mSCGB1A1 cyt-746 Recombinant Mouse Uteroglobin

SHH cyt-676 Recombinant Human Sonic HedgeHog

SHH, His cyt-717 Recombinant Human Sonic HedgeHog, His Tag

mSHH cyt-597 Recombinant Mouse Sonic HedgeHog

mSHH, His cyt-711 Recombinant Mouse Sonic HedgeHog, His Tag

DHH cyt-467 Recombinant Human Desert HedgeHog

DHH (C23II) cyt-362 Recombinant Human Desert HedgeHog (C23II)

sRANKL cyt-334 Recombinant Human Soluble RANK Ligand

sRANKL His cyt-692 Recombinant Human Soluble RANK Ligand, His Tag

sRANKL GST cyt-631 Recombinant Human Soluble RANK Ligand, GST Tag

msRANKL cyt-320 Recombinant Mouse Soluble RANK Ligand

sRANK Receptor cyt-734 Recombinant Human Soluble RANK Receptor

mRELM a cyt-309 Recombinant Mouse RELM-alpha

mRELM a His cyt-453 Recombinant Mouse RELM-alpha His Tag

RELM b cyt-454 Recombinant Human RELM-beta

mRELM b cyt-413 Recombinant Mouse RELM-beta

mRELM g cyt-455 Recombinant Mouse RELM-Gamma

Resistin cyt-456 Recombinant Human Resistin

Resistin His cyt-256 Recombinant Human Resistin, His Tag

Resistin Mutant cyt-585 Recombinant Human Resistin Mutant

mResistin cyt-457 Recombinant Mouse Resistin

rResistin cyt-458 Recombinant Rat Resistin

RBP1 cyt-122 Recombinant Human Retinol Binding Protein-1

RBP4 cyt-535 Recombinant Human Retinol Binding Protein-4

RBP4 His cyt-555 Recombinant Human Retinol Binding Protein-4 His Tag

RBP5 cyt-650 Recombinant Human Retinol Binding Protein-5

RBP7 cyt-023 Recombinant Human Retinol Binding Protein-7

SAA1 cyt-675 Recombinant Human Serum Amyloid A (APO-SAA1)

rmSAA1 cyt-719 Recombinant Rhesus Macaque Serum Amyloid A (APO-SAA1)

SAA4 cyt-002 Recombinant Human Serum Amyloid A4

SCF cyt-255 Recombinant Human Stem Cell Factor

mSCF cyt-275 Recombinant Mouse Stem Cell Factor

rSCF cyt-323 Recombinant Rat Stem Cell Factor

SCF Sf9 cyt-421 Recombinant Human Stem Cell Factor, Sf9

SCF HEK cyt-111 Recombinant Human Stem Cell Factor, HEK

k9SCF cyt-194 Recombinant Canine Stem Cell Factor

SF20 cyt-622 Recombinant Human Chromosome 19 Open Reading Frame 10

mSF20 cyt-678 Recombinant Mouse Chromosome 19 Open Reading Frame 10

SPP1 cyt-635 Recombinant Human Osteopontin

SPP1 HEK cyt-047 Recombinant Human Osteopontin, HEK

TACI cyt-032 Recombinant Human Tumor Necrosis Factor Receptor 13B

TAFA2 cyt-118 Recombinant Human Family with Sequence Similarity 19 Member A2

TDGF1 cyt-712 Recombinant Human Teratocarcinoma-Derived Growth Factor 1

TFF1 cyt-586 Recombinant Human Trefoil Factor-1

TFF1 His cyt-610 Recombinant Human Trefoil Factor-1 His Tag

TFF2 cyt-612 Recombinant Human Trefoil Factor-2

TFF2 His cyt-611 Recombinant Human Trefoil Factor-2 His Tag

TFF3 cyt-005 Recombinant Human Trefoil Factor-3

TFF3 His cyt-616 Recombinant Human Trefoil Factor-3 His Tag

TGF b 1 cyt-716 Recombinant Human Transforming Growth Factor-Beta 1

TGF b 1 cyt-561 Human Transforming Growth Factor-Beta 1

TGF b 1 GST cyt-473 Recombinant Human Transforming Growth Factor-Beta 1, GST tag

TGF b 1 His cyt-672 Recombinant Human Transforming Growth Factor-Beta 1 His Tag

TGF b 1 (113 a.a.) cyt-679 Recombinant Human Transforming Growth Factor-Beta 1 (113 a.a.)

TGF b 2 cyt-441 Recombinant Human Transforming Growth Factor-Beta 2

TGF b 2 HEK cyt-112 Recombinant Human Transforming Growth Factor-Beta 2, HEK

TGF b 3 cyt-368 Recombinant Human Transforming Growth Factor-Beta 3

TGF b 3 CHO cyt-685 Recombinant Human Transforming Growth Factor-Beta 3, CHO

TGF b 3 Plant cyt-588 Recombinant Human Transforming Growth Factor-Beta 3, Plant

TGF b 3 HEK cyt-113 Recombinant Human Transforming Growth Factor-Beta 3, HEK

TGF b 3 (207 a.a.) cyt-319 Recombinant Human Transforming Growth Factor-Beta 3 (644-850)

mTGF b 3 cyt-143 Recombinant Mouse Transforming Growth Factor-Beta 3

4 1BBR cyt-463 Recombinant Human 4-1BB Receptor

4 1BBR, His cyt-137 Recombinant Human 4-1BB Receptor His Tag

4 1BBL cyt-149 Recombinant Human 4-1BB Ligand

4 1BBL, His cyt-649 Recombinant Human 4-1BB Ligand, His Tag

TNF a cyt-223 Recombinant Human Tumor Necrosis Factor-alpha

TNF a His cyt-494 Recombinant Human Tumor Necrosis Factor-alpha, His Tag

TNF a HEK cyt-114 Recombinant Human Tumor Necrosis Factor-alpha, HEK

mTNF a cyt-252 Recombinant Mouse Tumor Necrosis Factor-alpha

rTNF a cyt-393 Recombinant Rat Tumor Necrosis Factor-alpha

rpTNF a cyt-405 Recombinant Porcine Tumor Necrosis Factor-alpha

raTNF a cyt-008 Recombinant Rabbit Tumor Necrosis Factor-alpha

rCaTNF a cyt-140 Recombinant Canine Tumor Necrosis Factor-alpha

rmTNF a cyt-737 Recombinant Rhesus Macaque Tumor Necrosis Factor-alpha

TNF a Mutant cyt-384 Recombinant Human Tumor Necrosis Factor-alpha, Mutant

TNF b cyt-224 Recombinant Human Tumor Necrosis Factor-beta

TNF b His cyt-495 Recombinant Human Tumor Necrosis Factor-beta, His Tag

TNFR2 cyt-674 Recombinant Human Tumor Necrosis Factor Receptor Type 2

TNFR2 Fc cyt-422 Recombinant Human Tumor Necrosis Factor Receptor 2 Fusion Protein

TNFRSF17 cyt-598 Recombinant Human B-Cell Maturation Antigen

TNFRSF17, His cyt-190 Recombinant Human B-Cell Maturation Antigen, His Tag

TNFR cyt-707 Recombinant Human Tumor Necrosis Factor Receptor

TNFR His cyt-673 Recombinant Human Tumor Necrosis Factor Receptor Type His Tag

TNFSF12 cyt-699 Recombinant Human TNF Ligand Superfamily Member 12

TNFRSF10B cyt-069 Recombinant Human TNF Ligand Receptor Superfamily Member 10B

TNFRSF12A cyt-043 Recombinant Human TNF Ligand Receptor Superfamily Member 12A

TSLP cyt-572 Recombinant Human Thymic Stromal Lymphopoietin

TSLPR cyt-742 Recombinant Human Thymic Stromal Lymphopoietin Receptor

TPO cyt-302 Recombinant Human Thrombopoietin

TPO CHO cyt-462 Recombinant Human Thrombopoietin, CHO

TPO HEK cyt-115 Recombinant Human Thrombopoietin, HEK

mTPO cyt-346 Recombinant Mouse Thrombopoietin

TRAIL cyt-443 Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L

TRAIL (114-281 a.a.) cyt-546 Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L (114-281)

ULBP1 cyt-166 Recombinant Human UL16 Binding Protein 1

Vaspin cyt-459 Recombinant Human Vaspin

VEGF cyt-241 Recombinant Human Vascular Endothelial Growth Factor

VEGF His cyt-496 Recombinant Human Vascular Endothelial Growth Factor, His Tag

VEGF CHO cyt-260 Recombinant Human Vascular Endothelial Growth Factor, CHO

VEGF HEK cyt-225 Recombinant Human Vascular Endothelial Growth Factor, HEK

VEGF Yeast cyt-577 Recombinant Human Vascular Endothelial Growth Factor, Yeast

VEGF (121a.a.) cyt-343 Recombinant Human Vascular Endothelial Growth Factor (121)

VEGF (121a.a.) Sf9 cyt-200 Recombinant Human Vascular Endothelial Growth Factor (121), Sf9

VEGF (121a.a.) His cyt-619 Recombinant Human Vascular Endothelial Growth Factor (121), His Tag

VEGF (121a.a.) HEK cyt-116 Recombinant Human Vascular Endothelial Growth Factor (121), HEK

rmVEGF cyt-336 Recombinant Mouse Vascular Endothelial Growth Factor

mVEGF Sf9 cyt-226 Recombinant Mouse Vascular Endothelial Growth Factor-Sf9

rmVEGF (121a.a.) cyt-574 Recombinant Mouse Vascular Endothelial Growth Factor (121)

rmVEGF His cyt-680 Recombinant Mouse Vascular Endothelial Growth Factor, His Tag

rVEGF cyt-392 Recombinant Rat Vascular Endothelial Growth Factor

VEGFB cyt-628 Recombinant Human Vascular Endothelial Growth Factor B

VEGF C cyt-527 Recombinant Human Vascular Endothelial Growth Factor Related Protein

rVEGF C cyt-262 Recombinant Rat Vascular Endothelial Growth Factor Related Protein

rVEGF C (152a.a.) cyt-284 Recombinant Rat Vascular Endothelial Growth Factor-C (152)

VEGF D cyt-045 Recombinant Human Vascular Endothelial Growth Factor D

VEGF E (Orf Virus) cyt-263 Recombinant Vascular Endothelial Growth Factor-E (Orf Virus)

VEGI cyt-517 Recombinant Human Vascular Endothelial Growth Inhibitor

VEGI His cyt-589 Recombinant Human Vascular Endothelial Growth Inhibitor, His Tag

Visfatin cyt-318 Recombinant Human Visfatin

Visfatin His cyt-563 Recombinant Human Visfatin, His Tag

mVisfatin cyt-447 Recombinant Mouse Visfatin

重慶市華雅干細(xì)胞技術(shù)有限公司 ：

該公司其他分類產(chǎn)品信息查看所有產(chǎn)品

以上信息由企業(yè)自行提供，信息內(nèi)容的真實性、準(zhǔn)確性和合法性由相關(guān)企業(yè)負(fù)責(zé)，化工儀器網(wǎng)對此不承擔(dān)任何保證責(zé)任。
溫馨提示：為規(guī)避購買風(fēng)險，建議您在購買產(chǎn)品前務(wù)必確認(rèn)供應(yīng)商資質(zhì)及產(chǎn)品質(zhì)量。